Federal Trade Commission · via Voidly Atlas
ftc-doj-charge-amazon-violating-childrens-privacy-law-keeping-kids-alexa-voice-recordings-forever
This is the agency's own public-domain data, curated and made citable by Voidly. Voidly adds no independent claim — always verify against the linked canonical source.
title
FTC and DOJ Charge Amazon with Violating Children’s Privacy Law by Keeping Kids’ Alexa Voice Recordings Forever and Undermining Parents’ Deletion Requests
release date
2023-05-01
category
childrens-privacy
penalty usd
—
Cite this record
FTC and DOJ Charge Amazon with Violating Children’s Privacy Law by Keeping Kids’ Alexa Voice Recordings Forever and Undermining Parents’ Deletion Requests. Federal Trade Commission, via Voidly Atlas — Surveillance & Digital-Rights Watch. Retrieved 2026-06-07, https://voidly.ai/atlas/federal/ftc-privacy/ftc-doj-charge-amazon-violating-childrens-privacy-law-keeping-kids-alexa-voice-recordings-forever
@misc{voidly_ftc_privacy_ftcdojchargeamazonviolatingchildrensprivacylawkeepingkidsalexavoicerecordingsforever,
title = {FTC and DOJ Charge Amazon with Violating Children’s Privacy Law by Keeping Kids’ Alexa Voice Recordings Forever and Undermining Parents’ Deletion Requests},
author = {{Voidly}},
howpublished = {\url{https://voidly.ai/atlas/federal/ftc-privacy/ftc-doj-charge-amazon-violating-childrens-privacy-law-keeping-kids-alexa-voice-recordings-forever}},
note = {Source: FTC press releases, https://www.ftc.gov/news-events/news/press-releases/2023/05/ftc-doj-charge-amazon-violating-childrens-privacy-law-keeping-kids-alexa-voice-recordings-forever. Public domain (17 U.S.C. §105); re-surfaced under CC BY 4.0},
urldate = {2026-06-07},
year = {2026}
}Also available as JSON/BibTeX/APA: API record. Source data is U.S. federal public domain (17 U.S.C. §105). Re-surfaced by Voidly under CC BY 4.0.